Analytical Data
-
Gene name
MPV17
- Application
-
Alternative Names
MPV17；Protein Mpv17
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P39210
-
Expression Region
1-176aa
-
AA Sequence
MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL
-
Molecular Weight
35.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of MPV17 recombinant protein is rooted in its significance in mitochondrial biology and genetics. MPV17 is a nuclear-encoded protein located in the inner mitochondrial membrane, playing a crucial role in mitochondrial DNA (mtDNA) maintenance and respiratory function. Mutations in the MPV17 gene have been linked to various mitochondrial disorders, notably those affecting energy metabolism, leading to conditions such as hepatopathy, sensorineural hearing loss, and neuromuscular symptoms. Understanding the structure and function of MPV17 is essential for elucidating the mechanisms underlying these diseases. Researchers aim to characterize the recombinant MPV17 protein to explore its interactions with mitochondrial components and its role in maintaining mitochondrial integrity. By employing techniques such as gene cloning, protein expression, and purification, scientists seek to produce functional MPV17 for in vitro studies. This research not only enhances the understanding of mitochondrial diseases caused by MPV17 mutations but also opens potential avenues for therapeutic interventions, including gene therapy and drug development targeting mitochondrial dysfunction. As such, the investigation into MPV17 recombinant protein holds promise for advancing our knowledge of mitochondrial pathophysiology and improving treatment strategies for affected individuals.
