Cat: PA1000-4934

Recombinant Human PSG9 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PSG9

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PSG9;PSG11;Pregnancy-specific beta-1-glycoProtein 9

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q00887

  • Expression Region

    35-426aa

  • AA Sequence

    EVTIEAQPPKVSEGKDVLLLVHNLPQNLPGYFWYKGEMTDLYHYIISYIV DGKIIIYGPAYSGRETVYSNASLLIQNVTRKDAGTYTLHIIKRGDETREE IRHFTFTLYLETPKPYISSSNLNPREAMEAVRLICDPETLDASYLWWMNG QSLPVTHRLQLSKTNRTLYLFGVTKYIAGPYECEIRNPVSASRSDPVTLN LLPKLPIPYITINNLNPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSP GVKRPIENRILILPSVTRNETGPYQCEIQDRYGGLRSNPVILNVLYGPDL PRIYPSFTYYRSGENLDLSCFTESNPPAEYFWTINGKFQQSGQKLFIPQI TRNHSGLYACSVHNSATGKEISKSMTVKVSGPCHGDLTESQS

  • Molecular Weight

    69 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PSG9, or Pregnancy-Specific Glycoprotein 9, is a member of the pregnancy-specific glycoprotein family, which is primarily expressed in the placenta. These glycoproteins play crucial roles in various biological processes, including immune modulation, cell adhesion, and fetal growth, making them essential for successful pregnancy outcomes. The study of PSG9 has gained significant attention due to its potential implications in reproductive health and prenatal diagnostics. Recent research has highlighted that PSG9 may contribute to the maternal-fetal interface by influencing the immune response and promoting tolerance towards the fetus. Additionally, abnormal levels of PSG9 have been associated with various pregnancy complications, including preeclampsia and fetal growth restrictions. Understanding the structure and function of PSG9 through recombinant protein technologies could provide insights into its role in pregnancy and possibly lead to the development of novel biomarkers for monitoring pregnancy health. Furthermore, the exploration of PSG9's interactions with immune cells and its signaling pathways may uncover new therapeutic targets for managing pregnancy-related disorders. As research continues to advance, the recombinant production of PSG9 protein enables comprehensive studies, paving the way for innovative approaches in prenatal care and enhancing our understanding of placental biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US