Analytical Data
-
Gene name
MLF1
- Application
-
Alternative Names
MLF1；Myeloid leukemia factor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P58340
-
Expression Region
1-268aa
-
AA Sequence
MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK
-
Molecular Weight
57.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MLF1 (Myeloid Leukemia Factor 1) is a protein that has gained significant attention in the field of cancer research due to its role in hematopoiesis and its association with myeloid leukemia. Initially identified as a fusion partner in the MLF1/MLL (Mixed-Lineage Leukemia) gene rearrangement in acute myeloid leukemia (AML), MLF1 is known to function as a transcriptional regulator. Studies have shown that MLF1 can influence the differentiation and proliferation of hematopoietic stem cells, making it a crucial player in normal blood cell development. Furthermore, aberrations in MLF1 expression levels are linked to poor prognosis in AML patients, suggesting its potential as a biomarker for disease progression. Recent research has focused on the molecular mechanisms by which MLF1 modulates gene expression and its interactions with other proteins involved in hematopoietic signaling pathways. Understanding these mechanisms may contribute to the development of targeted therapies aimed at correcting MLF1-related dysregulation in leukemia. Additionally, MLF1's involvement in other malignancies has prompted investigations into its role in tumorigenesis, paving the way for broader implications in cancer biology. Overall, ongoing studies of MLF1 recombinant protein are crucial for elucidating its functional roles and potential therapeutic applications, emphasizing the need for advanced research in this promising area of study.
