Cat: PA1000-4927

Recombinant Human IL-5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL-5;IL5R;Interleukin-5 receptor subunit alpha

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P05113

  • Expression Region

    20-134aa

  • AA Sequence

    IPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQ GIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYL QEFLGVMNTEWIIES

  • Molecular Weight

    13 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-5 (IL-5) is a cytokine primarily produced by T-helper type 2 (Th2) cells, playing a pivotal role in the regulation of eosinophil production, differentiation, and activation. Research into recombinant IL-5 was largely motivated by its significance in various eosinophil-associated diseases, including asthma, eosinophilic esophagitis, and hypereosinophilia. Elevated levels of IL-5 have been implicated in the pathophysiology of these disorders, leading to inflammation and tissue damage due to eosinophil overactivation. The development of recombinant IL-5 has facilitated the understanding of its biological functions and enabled the establishment of targeted therapies aimed at inhibiting its action. For instance, monoclonal antibodies targeting IL-5 or its receptor have been developed and are currently used as biologic treatments for severe asthma, demonstrating a marked reduction in exacerbation rates and improved lung function. Additionally, ongoing studies investigate the potential of IL-5 antagonists in treating other allergic and inflammatory conditions. The continued exploration of IL-5 and its pathways not only enhances our understanding of eosinophil biology but also provides a foundation for novel therapeutic strategies aimed at managing conditions driven by Th2 cell-mediated inflammation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US