Analytical Data
-
Gene name
PIGF
- Application
-
Alternative Names
PIGF；Phosphatidylinositol-glycan biosynthesis class F Protein
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49764
-
Expression Region
19-158aa
-
AA Sequence
VHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHI FSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMT FSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
-
Molecular Weight
16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PIGF, or Placenta Growth Factor, is a member of the vascular endothelial growth factor (VEGF) family, primarily involved in angiogenesis and vascular permeability. Research has shown that PIGF plays a crucial role in various physiological and pathological processes, including fetal development, wound healing, and tumor growth. Elevated levels of PIGF have been associated with several diseases, such as cancer, diabetic retinopathy, and preeclampsia, making it a significant target for therapeutic intervention. Recombinant PIGF proteins are generated to study their function and to explore their potential applications in treating related disorders. By creating recombinant forms of PIGF, researchers can investigate its mechanisms of action, evaluate its interactions with receptors, and assess its therapeutic efficacy. This research holds promise for developing novel strategies to modulate angiogenesis in disease contexts, ultimately contributing to improved clinical outcomes in conditions characterized by aberrant vascular function. Enhanced understanding of PIGF could pave the way for innovative therapies that harness or inhibit its activity, providing valuable insights into the management of diseases where angiogenesis plays a critical role.
