Analytical Data
-
Gene name
MEOX1
- Application
-
Alternative Names
MEOX1;MOX1;Homeobox Protein MOX-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P50221
-
Expression Region
1-254aa
-
AA Sequence
MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE
-
Molecular Weight
55.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MEOX1 (Mesodermal Homeobox 1) is a transcription factor that plays a crucial role in embryonic development, particularly in the formation and differentiation of mesoderm-derived tissues. Research has revealed that MEOX1 is involved in various developmental processes, including somite formation, limb development, and the patterning of the axial skeleton. Abnormal expression or mutations in MEOX1 have been linked to a range of congenital disorders, making it a significant target for studying developmental biology and associated pathologies. The recombinant MEOX1 protein allows researchers to explore its functional mechanisms at the molecular level. Through the generation of this protein, scientists can investigate its binding affinities to DNA, interaction with other proteins, and its regulatory effects on downstream target genes. Additionally, the availability of recombinant MEOX1 facilitates assays that can elucidate its role in cellular processes, such as differentiation and proliferation. Understanding MEOX1's function not only advances knowledge in developmental biology but also provides insights into potential therapeutic approaches for congenital malformations linked to MEOX1 dysregulation. This ongoing research underscores the importance of MEOX1 as a central player in the intricate network of gene regulation during development.











