Analytical Data
-
Gene name
CLIC4
- Application
-
Alternative Names
CLIC4；Chloride intracellular channel Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y696
-
Expression Region
1-253aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMALSMPLNGLKEEDKEPLIELFVKAGSDGE SIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITF NSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIK NSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLD GNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEF TNTCPSDKEVEIAYSDVAKRLTK
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLIC4 (Chloride Intracellular Channel 4) is a member of the CLIC protein family, which is known for its role in chloride ion transport across cellular membranes. Research into CLIC4 has garnered significant attention due to its involvement in various physiological and pathological processes, including cell proliferation, apoptosis, and cancer progression. Unlike other chloride channels, CLIC proteins exhibit unique characteristics, such as their ability to exist in both soluble and membrane-bound states, suggesting diverse functional roles within the cell. CLIC4, in particular, has been implicated in regulating cell signaling pathways and maintaining cellular homeostasis. Studies have revealed that CLIC4 is overexpressed in several types of tumors, pointing to its potential role as a biomarker for cancer diagnosis and prognosis. Furthermore, investigations into CLIC4’s structure and function could provide insights into its mechanism of action and interactions with other cellular components. Given its critical involvement in various biological processes and disease states, CLIC4 represents a promising target for therapeutic intervention, making it a focal point of research aimed at understanding its contributions to cellular physiology and pathology. Researchers are keen to explore the potential of CLIC4 in drug development, particularly in designing targeted therapies that can modulate its activity in cancer and other diseases. Overall, the study of CLIC4 not only enhances our understanding of chloride channel physiology but also holds promise for advancing therapeutic strategies in oncology and beyond.
