Analytical Data
-
Gene name
CSH1
- Application
-
Alternative Names
CSH1；Chorionic somatomammotropin hormone 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01243
-
Expression Region
27-217aa
-
AA Sequence
VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQT SFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANN LVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNS HNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGFVDHHHHHH
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CSH1, or Choriogonadotropin Subunit Hormone 1, is a crucial component of the human chorionic gonadotropin (hCG), a glycoprotein hormone essential for maintaining pregnancy and regulating reproductive processes. Research on CSH1 recombinant protein has gained attention due to its significant role in fertility treatments and pregnancy monitoring. The recombinant production of CSH1 allows for the generation of large quantities of this protein, facilitating studies on its structure-function relationship, as well as its interactions with receptors and other hormonal pathways. Additionally, CSH1's involvement in various reproductive disorders and potential implications in cancer biology, particularly in trophoblastic tumors, underscores the importance of understanding its biological functions. Advances in biotechnology have enabled the engineering of CSH1 for therapeutic applications and better diagnostic tools, making it a promising target for further research. Given the complexity of its glycosylation patterns and the necessity for post-translational modifications, the study of recombinant CSH1 not only provides insights into reproductive endocrinology but also paves the way for innovative strategies in reproductive health and disease management.
