Analytical Data
-
Gene name
KLK1
- Application
-
Alternative Names
KLK1；Kallikrein-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P06870
-
Expression Region
25-262aa
-
AA Sequence
IVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS
-
Molecular Weight
42.4kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KLK1, or Kallikrein-related peptidase 1, is a member of the kallikrein family of serine proteases known for its role in various physiological processes, including blood pressure regulation, reproductive functions, and the modulation of inflammatory responses. Research into KLK1 has gained momentum due to its emerging importance in the diagnosis and therapeutic targeting of diseases, particularly cancer and cardiovascular disorders. Elevated levels of KLK1 have been associated with poor prognosis in several malignancies, suggesting its potential as a biomarker for early detection and monitoring of tumor progression. Additionally, KLK1 is being investigated for its role in the renin-angiotensin system, which is critical for maintaining vascular homeostasis. With advances in recombinant DNA technology, producing KLK1 in a recombinant form has become feasible, enabling detailed studies of its structure-function relationships, enzymatic activity, and interaction with specific substrates or inhibitors. This research not only enhances our understanding of KLK1's biological roles but also paves the way for the development of KLK1-based diagnostic tools and therapeutic agents. Overall, the study of KLK1 recombinant protein is vital to unraveling its clinical significance and exploring its potential applications in precision medicine.
