Cat: PA1000-4848

Recombinant Human CYB5B Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CYB5B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CYB5B;CYB5M;OMB5;Cytochrome b5 type B

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O43169

  • Expression Region

    16-122aa

  • AA Sequence

    KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSC

  • Molecular Weight

    43.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Cytochrome b5 type B (CYB5B) is an essential membrane-bound heme protein that plays a crucial role in various biological processes, including electron transfer and lipid metabolism. It is primarily expressed in the endoplasmic reticulum and is involved in the desaturation and elongation of fatty acids, as well as in the metabolism of drugs and xenobiotics. Research into CYB5B has gained traction due to its implications in cellular respiration and its potential contributions to metabolic disorders. Mutations in the CYB5B gene are associated with specific diseases, including congenital methemoglobinemia, highlighting its importance in maintaining proper cellular function. Recombinant CYB5B protein production has enabled researchers to investigate its biochemical properties, interactions with other proteins, and role in metabolic pathways more thoroughly. The characterization of this protein can provide critical insights into its function and regulation, potentially unveiling new therapeutic targets for disorders linked to its dysfunction. Furthermore, understanding CYB5B's mechanism of action could lead to advancements in biotechnology and the development of novel drug delivery systems. Overall, the study of CYB5B and its recombinant protein form is significant for elucidating fundamental biological functions and addressing various clinical challenges.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US