Analytical Data
-
Gene name
PITPNA
- Application
-
Alternative Names
PITPNA;PITPN;Phosphatidylinositol transfer Protein alpha isoform
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q00169
-
Expression Region
1-270aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMVLLKEYRVILPVSVDEYQVGQLYSVAEAS KNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGA LNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEP EAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQE LVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFC WLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD
-
Molecular Weight
34 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PITPNA (Phosphatidylinositol transfer protein alpha) is a member of the phosphatidylinositol transfer protein family, which is involved in the intracellular transport of phospholipids, particularly phosphatidylinositol, between membranes. Research on PITPNA has garnered attention due to its pivotal role in various cellular processes, including signal transduction, membrane trafficking, and lipid metabolism. Dysregulation of PITPNA is implicated in several diseases, including cancer and neurodegenerative disorders, highlighting its therapeutic potential. The protein's ability to facilitate the transfer of lipids is critical for maintaining cellular homeostasis and regulating membrane dynamics. Studies have shown that PITPNA influences the synthesis of second messengers involved in various signaling pathways, suggesting a broader impact on cellular signaling cascades. Recent advancements in recombinant protein technology have enabled the production of PITPNA in heterologous systems, providing quantities sufficient for detailed functional and structural analyses. Understanding the mechanism by which PITPNA operates at the molecular level could pave the way for novel strategies in drug development and the treatment of associated diseases. Moreover, elucidating its interactions with other cellular components could enhance our comprehension of membrane biology and the intricate networks governing cellular function. As research progresses, PITPNA continues to emerge as a critical factor in lipid signaling and membrane organization, warranting further exploration of its biological significance and potential applications in medical science.











