Analytical Data
-
Gene name
KCND1
- Application
-
Alternative Names
KCND1；Potassium voltage-gated channel subfamily D member 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NSA2
-
Expression Region
410-647aa
-
AA Sequence
NFSRIYHQNQRADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHHLLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRRAIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIISIPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL
-
Molecular Weight
29.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCND1, also known as the potassium voltage-gated channel subfamily D member 1, encodes a member of the voltage-gated potassium channel family that plays a crucial role in repolarizing the cardiac action potential and regulating neuronal excitability. Research into KCND1 has gained significant interest due to its implications in various physiological processes and potential pathophysiological conditions, including cardiac arrhythmias and neurological disorders. The dysfunction of KCND1 channels can lead to altered neuronal firing and cardiac rhythm disturbances, highlighting the importance of understanding their molecular mechanisms. Recent studies have focused on the recombinant expression of KCND1 protein to investigate its biophysical properties, channel kinetics, and interaction with pharmacological agents. Advances in protein engineering and purification techniques have allowed for the production of functional KCND1 channels in heterologous systems, facilitating detailed investigations of their structure-function relationships. Furthermore, understanding KCND1's role in the context of specific diseases may provide insights for developing targeted therapies. As research continues, KCND1 remains a compelling target for elucidating the intricate balance of electrical signaling in both the heart and the nervous system, contributing to the broader field of ion channel biology and its therapeutic potentials.
