Cat: PA1000-4832

Recombinant Human INPP5A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    INPP5A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    INPP5A;5PTASE;Inositol polyphosphate-5-phosphatase A

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14642

  • Expression Region

    1-410aa

  • AA Sequence

    MAGKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMA LHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEH FTALGSFYFLHESLKNIYQFDFKAKKYRKVAGKEIYSDTLESTPMLEKEK FPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPS VYSGIRHKALGYVLDRIIDQRFEKVSYFVFGDFNFRLDSKSVVETLCTKA TMQTVRAADTNEVVKLIFRESDNDRKVMLQLEKKLFDYFNQEVFRDNNGT ALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDR ILMSPSAKELVLRSESEEKVVTYDHIGPNVCMGDHKPVFLAFRIMPGAGK PHAHVHKCCVDHHHHHH

  • Molecular Weight

    49 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

INPP5A (Inositol Polyphosphate-5-Phosphatase A) is a key enzyme involved in the regulation of several cellular processes, including signal transduction and phosphoinositide metabolism. By hydrolyzing inositol trisphosphate and playing a crucial role in the generation of second messengers, INPP5A influences various physiological functions such as cell growth, differentiation, and apoptosis. Its dysregulation has been implicated in a variety of diseases, including cancer, where altered phosphoinositide signaling contributes to tumorigenesis and metastasis. The study of recombinant INPP5A protein is essential for understanding its biochemical properties, substrate specificity, and interaction with other signaling molecules. These investigations can uncover the pathways that INPP5A modulates and reveal its potential as a therapeutic target. Advances in recombinant DNA technology and protein purification methods have facilitated the expression and characterization of functional INPP5A protein, allowing researchers to explore its role in cellular signaling further. Understanding the structural and functional aspects of INPP5A not only enhances our fundamental knowledge of phosphoinositide metabolism but also paves the way for the development of novel strategies to manipulate its activity in disease contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US