Analytical Data
-
Gene name
IFI6
- Application
-
Alternative Names
IFI6;G1P3;Interferon alpha-inducible Protein 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09912
-
Expression Region
24-130aa
-
AA Sequence
GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE
-
Molecular Weight
12.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IFI6, or Interferon-Inducible Protein 6, is a member of the interferon-stimulated gene (ISG) family, which plays a critical role in the innate immune response. Initially identified for its antiviral properties, IFI6 is upregulated upon interferon treatment and has been associated with the host's defense mechanisms against viral infections, particularly in the context of RNA viruses. Research has indicated that IFI6 functions by modulating cellular pathways, potentially enhancing the sensitivity of cells to viral threats. Recent studies have explored its involvement in apoptosis, inflammation, and cell signaling, revealing its multifaceted role in immune regulation. Furthermore, IFI6 has been implicated in various diseases, including cancer, where its expression levels could influence tumor progression and response to therapy. The recombinant production of IFI6 protein serves as a fundamental tool for understanding its biological functions, interactions, and potential as a therapeutic target. Investigating the structure and activity of IFI6 through recombinant technology may unveil novel insights into its role in immune responses and disease pathogenesis, paving the way for innovative treatment strategies.











