Analytical Data
-
Gene name
TNFSF4
- Application
-
Alternative Names
TNFSF4;TXGP1;Tumor necrosis factor ligand superfamily member 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P23510
-
Expression Region
52-183aa
-
AA Sequence
QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGF YLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVY LNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFSF4, also known as OX40L, is a member of the tumor necrosis factor (TNF) superfamily and plays a crucial role in immune regulation, particularly in T cell activation and survival. It is primarily expressed on activated antigen-presenting cells and interacts with its receptor OX40, which is found on T cells. This interaction enhances T cell responses, contributing to antibody production and the development of memory T cells. Research into TNFSF4 has gained significant attention due to its potential implications in cancer immunotherapy, autoimmune diseases, and chronic infections. Enhanced understanding of TNFSF4 signaling pathways may pave the way for novel therapeutic strategies aimed at modulating immune responses, thus improving treatment outcomes in various diseases. Furthermore, recombinant TNFSF4 proteins are being explored as potential agents for boosting immune responses in vaccine development and as targets for monoclonal antibody therapies. Investigations into the structural and functional properties of TNFSF4, alongside its role in the tumor microenvironment, continue to be vital for elucidating its contribution to immune modulation and for exploiting its potential in clinical applications.











