Analytical Data
-
Gene name
HLA-G
- Application
-
Alternative Names
HLA-G；HLA-6.0；HLAG；HLA class I histocompatibility antigen. alpha chain G
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P17693
-
Expression Region
25-338aa
-
AA Sequence
DAAQPARRAVRSLHHHHHHHHHHLVPRGSRTGSHSMRYFSAAVSRPGRGE PRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKA HAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYD GKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLH RYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQR DGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEP LMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
-
Molecular Weight
40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HLA-G is a type of non-classical major histocompatibility complex (MHC) molecule that plays a crucial role in immune regulation, particularly during pregnancy and in various pathological conditions such as tumors and autoimmune diseases. Unlike classical MHC class I molecules that present antigens to cytotoxic T cells, HLA-G exhibits unique immunomodulatory properties, including the ability to inhibit natural killer (NK) cell activity and modulate T cell responses, thereby contributing to fetal tolerance. Due to its selective expression in trophoblasts and certain tumors, HLA-G has garnered attention as a potential biomarker for various diseases and a target for therapeutic intervention. Research focuses on the production of recombinant HLA-G proteins to elucidate their functional roles and mechanisms of action in immune response modulation. The availability of high-purity recombinant HLA-G proteins allows for detailed investigations into their interactions with ligands, receptors, and signaling pathways, which may pave the way for novel therapeutic approaches in immunotherapy and transplantation. Understanding HLA-G’s structure-function relationship can provide insights into its complex biological roles and guide the development of strategies aimed at manipulating immune responses in clinical settings.
