Cat: PA1000-4702

Recombinant Human CLIC3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CLIC3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CLIC3;Chloride intracellular channel Protein 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95833

  • Expression Region

    1-236aa

  • AA Sequence

    MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSP DVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRE SNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHEL AGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELR GVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPRLEHHHHHH

  • Molecular Weight

    28 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CLIC3 (Chloride Intracellular Channel 3) is a member of the CLIC family of proteins, which are known for their roles as chloride channels and their involvement in various physiological processes. The study of CLIC3 has garnered attention due to its implications in cellular signaling, ion homeostasis, and potential roles in cancer progression and other diseases. Unlike traditional chloride channels, CLIC proteins possess a unique ability to exist in both membrane-bound and soluble forms, implicating them in diverse cellular functions beyond mere ion transport. Research has indicated that CLIC3 may be involved in cellular processes such as apoptosis, cell proliferation, and migration, which are critical in cancer biology. Additionally, alterations in CLIC3 expression and function have been observed in various cancers, suggesting its potential as a biomarker or therapeutic target. Thus, the investigation of CLIC3 recombinant proteins aims to elucidate their structure-function relationships, mechanisms of action, and interactions with other cellular components. Understanding these aspects through recombinant protein studies can provide valuable insights into the physiological and pathological roles of CLIC3, paving the way for novel therapeutic approaches targeting CLIC3 in diseases where its dysregulation is implicated.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US