Analytical Data
-
Gene name
CLIC3
- Application
-
Alternative Names
CLIC3;Chloride intracellular channel Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95833
-
Expression Region
1-236aa
-
AA Sequence
MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSP DVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRE SNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHEL AGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELR GVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPRLEHHHHHH
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLIC3 (Chloride Intracellular Channel 3) is a member of the CLIC family of proteins, which are known for their roles as chloride channels and their involvement in various physiological processes. The study of CLIC3 has garnered attention due to its implications in cellular signaling, ion homeostasis, and potential roles in cancer progression and other diseases. Unlike traditional chloride channels, CLIC proteins possess a unique ability to exist in both membrane-bound and soluble forms, implicating them in diverse cellular functions beyond mere ion transport. Research has indicated that CLIC3 may be involved in cellular processes such as apoptosis, cell proliferation, and migration, which are critical in cancer biology. Additionally, alterations in CLIC3 expression and function have been observed in various cancers, suggesting its potential as a biomarker or therapeutic target. Thus, the investigation of CLIC3 recombinant proteins aims to elucidate their structure-function relationships, mechanisms of action, and interactions with other cellular components. Understanding these aspects through recombinant protein studies can provide valuable insights into the physiological and pathological roles of CLIC3, paving the way for novel therapeutic approaches targeting CLIC3 in diseases where its dysregulation is implicated.











