Analytical Data
-
Gene name
ERCC5
- Application
-
Alternative Names
ERCC5；ERCM2；XPG；XPGC；DNA excision repair Protein ERCC-5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28715
-
Expression Region
947-1186aa
-
AA Sequence
SFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDKAKGKTQKRGITNTLEESSSLKRKRLSDSKGKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT
-
Molecular Weight
30.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ERCC5, also known as Excision Repair Cross-Complementation Group 5, is a crucial enzyme involved in the nucleotide excision repair (NER) pathway, which plays a vital role in repairing bulky DNA adducts and various forms of DNA damage caused by environmental agents such as UV radiation and chemical carcinogens. Mutations in the ERCC5 gene are linked to xeroderma pigmentosum, a rare genetic disorder characterized by extreme sensitivity to sunlight and a predisposition to skin cancer. The study of ERCC5 recombinant proteins is essential for elucidating the mechanisms of NER and understanding its role in maintaining genomic stability. By producing and characterizing ERCC5 recombinant proteins, researchers aim to investigate their enzymatic activity, binding properties, and interactions with other proteins involved in the DNA repair process. This research not only enhances our understanding of DNA repair mechanisms but also has potential implications for developing targeted therapies for diseases associated with DNA repair deficiencies, including cancer. Furthermore, the investigation of ERCC5 may lead to advancements in gene therapy approaches and improve our knowledge of the molecular foundations underlying skin cancer susceptibility. Overall, the exploration of ERCC5 recombinant proteins represents a significant area of research that bridges molecular biology and clinical applications, offering insights that could lead to innovative strategies for disease prevention and treatment.
