Cat: PA2000-1985

Recombinant Human ERCC5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ERCC5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ERCC5;ERCM2;XPG;XPGC;DNA excision repair Protein ERCC-5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P28715

  • Expression Region

    947-1186aa

  • AA Sequence

    SFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDKAKGKTQKRGITNTLEESSSLKRKRLSDSKGKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT

  • Molecular Weight

    30.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ERCC5, also known as Excision Repair Cross-Complementation Group 5, is a crucial enzyme involved in the nucleotide excision repair (NER) pathway, which plays a vital role in repairing bulky DNA adducts and various forms of DNA damage caused by environmental agents such as UV radiation and chemical carcinogens. Mutations in the ERCC5 gene are linked to xeroderma pigmentosum, a rare genetic disorder characterized by extreme sensitivity to sunlight and a predisposition to skin cancer. The study of ERCC5 recombinant proteins is essential for elucidating the mechanisms of NER and understanding its role in maintaining genomic stability. By producing and characterizing ERCC5 recombinant proteins, researchers aim to investigate their enzymatic activity, binding properties, and interactions with other proteins involved in the DNA repair process. This research not only enhances our understanding of DNA repair mechanisms but also has potential implications for developing targeted therapies for diseases associated with DNA repair deficiencies, including cancer. Furthermore, the investigation of ERCC5 may lead to advancements in gene therapy approaches and improve our knowledge of the molecular foundations underlying skin cancer susceptibility. Overall, the exploration of ERCC5 recombinant proteins represents a significant area of research that bridges molecular biology and clinical applications, offering insights that could lead to innovative strategies for disease prevention and treatment.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US