Analytical Data
-
Gene name
IGHG4
- Application
-
Alternative Names
IGHG4;Immunoglobulin heavy constant gamma 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01861
-
Expression Region
99-326aa
-
AA Sequence
ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQ EDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKE YKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQ EGNVFSCSVMHEALHNHYTQKSLSLSLE
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of IgG4 recombinant proteins has garnered significant interest due to their unique structural and functional properties compared to other immunoglobulin classes. IgG4, a subclass of IgG, is known for its ability to undergo "Fab-arm exchange," where two different antibodies can combine to form a bispecific antibody, enhancing its therapeutic potential. This subclass is less inflammatory and has a distinct role in immune regulation, which is particularly relevant in the context of allergies and autoimmune diseases. Research on IgG4 recombinant proteins aims to explore their applications in biopharmaceuticals, including their use as therapeutic agents for treating chronic diseases and as tools in targeted therapies. Furthermore, IgG4 has been implicated in a tolerogenic response, making it an intriguing target for developing vaccines and immunotherapeutic strategies. The production of recombinant IgG4 proteins facilitates detailed studies on their mechanism of action and allows for the engineering of variants with improved efficacy and specificity. Overall, the exploration of IgG4 recombinant proteins is poised to expand our understanding of immune modulation and advance therapeutic interventions in various clinical settings.











