Cat: PA1000-4605

Recombinant Human SCARB1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SCARB1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SCARB1;CD36L1;CLA1;Scavenger receptor class B member 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8WTV0

  • Expression Region

    33-443aa

  • AA Sequence

    PSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGE KPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESD YIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWG YKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIH LVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEACRS MKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVS TCRFSAPLFLSHPHFLNADPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPM NCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESGAMEGETLHTFYT QLVLMPKVMHY

  • Molecular Weight

    73 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SCARB1, or scavenger receptor class B type I, is a key membrane protein primarily involved in high-density lipoprotein (HDL) metabolism and cholesterol homeostasis. As a receptor for HDL, SCARB1 plays a crucial role in mediating the selective uptake of cholesterol from HDL into cells. This function is especially important in hepatocytes and steroidogenic tissues, where cholesterol is vital for the synthesis of bile acids, steroid hormones, and cellular membranes. Dysregulation of SCARB1 has been linked to various metabolic disorders, including cardiovascular diseases and type 2 diabetes. Researchers have increasingly focused on SCARB1 as a potential therapeutic target for these conditions. The study of SCARB1 recombinant proteins allows for a deeper understanding of its structural and functional properties, facilitating the investigation of its role in lipid metabolism and its interactions with ligands such as HDL. Furthermore, recombinant SCARB1 can serve as a valuable tool in drug discovery and development, enabling the screening of small molecules that may modulate its activity. Overall, the exploration of SCARB1 and its recombinant variants holds promise for uncovering new insights into lipid metabolism and developing novel therapeutic strategies for cardiovascular and metabolic diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US