Analytical Data
-
Gene name
EIF5
- Application
-
Alternative Names
EIF5；Eukaryotic translation initiation factor 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55010
-
Expression Region
1-431aa
-
AA Sequence
MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHFLRFCHNNKKAQRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSDNKDDDIDIDAI
-
Molecular Weight
65.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EIF5 (Eukaryotic Translation Initiation Factor 5) is a crucial protein involved in the initiation phase of eukaryotic protein synthesis. It plays a pivotal role in the formation of the initiation complex by facilitating the recruitment of the ribosomal subunits and the methionyl-tRNA to the mRNA, thereby ensuring accurate translation. Given its essential function in the translation process, EIF5 has garnered interest in various fields of research, particularly in cancer biology and genetics. Abnormalities in EIF5 expression and function have been linked to several types of cancers, as altered protein synthesis can lead to enhanced proliferation and survival of cancer cells. Additionally, EIF5 is also a research focus in the context of viral infections, as many viruses hijack the host's translation machinery, including EIF5, to promote their own protein synthesis. The study of EIF5 and its interactions at the molecular level is critical for understanding the mechanisms of translation regulation and the development of potential therapeutic strategies. Researchers are exploring the repercussions of EIF5 dysregulation, as well as its structural properties and interactions with other translation factors. Understanding EIF5's role could lead to novel interventions targeting translation in diseases characterized by aberrant protein synthesis, ultimately contributing to the advancement of therapeutic approaches in cancer and viral infections.
