Analytical Data
-
Gene name
GPA33
- Application
-
Alternative Names
GPA33；Cell surface A33 antigen
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99795
-
Expression Region
22-235aa
-
AA Sequence
ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVI WPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSL MSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTP QYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQF CNITVAVRSPSMNVVDHHHHHH
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPA33 is a type of glycoprotein that is primarily expressed in human placenta and plays a significant role in cell adhesion, migration, and signaling pathways, making it a crucial target for cancer research. Its expression is often upregulated in various tumors, particularly in cancers of epithelial origin such as colorectal, breast, and lung cancers, which has prompted extensive investigations into its potential as a biomarker and therapeutic target. The unique expression pattern of GPA33 in cancerous tissues rather than in normal adult tissues positions it as an attractive candidate for targeted therapies, including antibody-drug conjugates and immunotherapies. Researchers are focusing on understanding its structural characteristics, interaction mechanisms, and the signaling pathways it influences to unlock new avenues for cancer treatment. Additionally, studies explore the use of GPA33 as a marker for tumor progression and prognosis, providing insights into its role in the metastatic process. These research efforts aim to leverage GPA33's properties to develop innovative diagnostic tools and therapeutic strategies, ultimately improving patient outcomes in oncological care. As the understanding of GPA33 continues to evolve, its potential implications in both basic and clinical research are paving the way for enhanced cancer management approaches.
