Analytical Data
-
Gene name
E2F6
- Application
-
Alternative Names
E2F6；Transcription factor E2F6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75461
-
Expression Region
1-281aa
-
AA Sequence
MSQQRPARKLPSLLLDPTEETVRRRCRDPINVEGLLPSKIRINLEDNVQY VSMRKALKVKRPRFDVSLVYLTRKFMDLVRSAPGGILDLNKVATKLGVRK RRVYDITNVLDGIDLVEKKSKNHIRWIGSDLSNFGAVPQQKKLQEELSDL SAMEDALDELIKDCAQQLFELTDDKENERLAYVTYQDIHSIQAFHEQIVI AVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCEVEQGQTSNKRSEG VGTSSSESTHPEGPEEEENPQQSEELLEVSN
-
Molecular Weight
57 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
E2F6 is a member of the E2F family of transcription factors, which play a crucial role in regulating the cell cycle and gene expression related to cell proliferation and differentiation. Unlike other E2F proteins, E2F6 primarily functions as a transcriptional repressor, contributing to the regulation of gene expression during various biological processes. Research on E2F6 has garnered interest due to its involvement in several key cellular functions, including cell cycle progression, response to DNA damage, and maintenance of stem cell pluripotency. Furthermore, E2F6 has been implicated in various cancer types, where its dysregulation can lead to uncontrolled cell growth and proliferation. Understanding the mechanisms governing E2F6 activity, including its interactions with co-repressors and other transcription factors, is vital for elucidating its role in tumorigenesis. Additionally, E2F6 is also a target of interest for therapeutic strategies, as modulating its function could potentially impact cancer progression. By studying E2F6 in the context of different cellular environments and disease states, researchers aim to uncover novel insights into its regulatory networks and develop targeted interventions for cancer treatment. The ongoing exploration of E2F6 continues to highlight its significance as a regulatory hub in cellular processes and its potential as a biomarker or therapeutic target in oncology.
