Analytical Data
-
Gene name
CCL16
- Application
-
Alternative Names
CCL16；ILINCK；NCC4；SCYA16；C-C motif chemokine 16
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15467
-
Expression Region
24-120aa
-
AA Sequence
QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNR E VCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
-
Molecular Weight
11 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCL16, also known as lymphotactin or XCL1, is a member of the C-C chemokine family that plays a crucial role in immune response and inflammation. It primarily attracts and activates specialized immune cells, such as T-cells and natural killer (NK) cells, which are vital for combating infections and tumors. Understanding CCL16's function and mechanisms has garnered significant interest in the fields of immunology and cancer research, as it could offer insights into developing novel therapeutic strategies. Recent studies have suggested that dysregulation of CCL16 may be implicated in various pathological conditions, including autoimmune diseases and cancer progression. The production and study of recombinant CCL16 protein have become increasingly important for elucidating its biological functions, examining its signaling pathways, and assessing its potential as a biomarker or therapeutic target. By generating a high-purity recombinant form of CCL16, researchers aim to conduct in-depth investigations into its interactions with receptors and other cellular components, as well as its role in modulating inflammation and immune reactions. Overall, the study of CCL16 is advancing our understanding of immune regulation and holds promise for developing innovative treatments for related diseases.
