Cat: PA2000-1944

Recombinant Human CRYGB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CRYGB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CRYGB;CRYG2;Gamma-crystallin B

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P07316

  • Expression Region

    1-175aa

  • AA Sequence

    MGKITFYEDRAFQGRSYECTTDCPNLQPYFSRCNSIRVESGCWMIYERPNYQGHQYFLRRGEYPDYQQWMGLSDSIRSCCLIPPHSGAYRMKIYDRDELRGQMSELTDDCISVQDRFHLTEIHSLNVLEGSWILYEMPNYRGRQYLLRPGEYRRFLDWGAPNAKVGSLRRVMDLY

  • Molecular Weight

    24.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CRYGB (Crystallin, Gamma B) is a member of the gamma-crystallin family, which plays a crucial role in maintaining lens transparency and refractive properties in the eye. These proteins are primarily expressed in the lens, where they contribute to the structural and functional integrity necessary for optimal vision. Research into CRYGB and its recombinant protein has garnered interest due to its potential implications in understanding cataract formation and other lens-related pathologies. Furthermore, CRYGB's stability and solubility characteristics make it a suitable candidate for studying protein folding and aggregation, which are critical factors in various ocular disorders. The recombinant expression of CRYGB allows for detailed biochemical analyses and the exploration of its interactions with other lens proteins, thus providing insights into the molecular mechanisms underlying lens clarity and the development of therapeutic approaches for lens opacities. Additionally, CRYGB serves as a model for studying protein disulfide bond formation and post-translational modifications, which are essential for the functional maturation of crystallins. Given the increasing incidence of cataracts globally, the study of CRYGB and its properties is not only important for basic science but also for developing novel strategies for preventing and treating lens-related diseases, highlighting its significance in both research and clinical contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US