Analytical Data
-
Gene name
COX7A2L
- Application
-
Alternative Names
COX7A2L；COX7AR；COX7RP；Cytochrome c oxidase subunit 7A-related Protein. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14548
-
Expression Region
1-114aa
-
AA Sequence
MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
-
Molecular Weight
39.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COX7A2L, a gene encoding a subunit of cytochrome c oxidase, plays a crucial role in the mitochondrial respiratory chain, which is essential for cellular energy production. Research into COX7A2L has gained interest due to its potential implications in various metabolic and neurodegenerative disorders. Abnormalities in mitochondrial function can lead to a range of diseases, including cardiovascular diseases, diabetes, and neurological disorders like Alzheimer’s and Parkinson’s. Given its involvement in bioenergetics, studying COX7A2L and characterizing its recombinant protein is vital for understanding its functional role and regulatory mechanisms in the mitochondria. Recent studies have focused on the expression and purification of recombinant COX7A2L to investigate its biochemical properties and interactions with other mitochondrial components. This research not only aims to elucidate the physiological roles of COX7A2L but also explores its potential as a therapeutic target for diseases linked to mitochondrial dysfunction. Insights gained from these studies may lead to novel approaches for the treatment and management of conditions associated with impaired mitochondrial activity.
