Cat: PA2000-1936

Recombinant Human COL6A2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    COL6A2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    COL6A2;Collagen alpha-2(VI) chain

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P12110

  • Expression Region

    254-400aa

  • AA Sequence

    IPGPSGPKGYRGQKGAKGNMGEPGEPGQKGRQGDPGIEGPIGFPGPKGVPGFKGEKGEFGADGRKGAPGLAGKNGTDGQKGKLGRIGPPGCKGDPGNRGPDGYPGEAGSPGERGDQGGKGDPGRPGRRGPPGEIGAKGSKGYQGNSG

  • Molecular Weight

    35.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

COL6A2, a member of the collagen VI family, plays a crucial role in the structural integrity and function of various tissues, particularly in the extracellular matrix (ECM). Mutations in the COL6A2 gene are associated with several connective tissue disorders, including Ullrich congenital muscular dystrophy and Bethlem myopathy, which are characterized by muscle weakness, joint contractures, and skin abnormalities. Researchers have focused on the recombinant expression of COL6A2 to better understand its biochemical properties and interactions within the ECM. Producing COL6A2 as a recombinant protein allows scientists to explore its role in cellular processes, including cell adhesion, proliferation, and differentiation. Furthermore, understanding the structure-function relationship of COL6A2 may reveal insights into the pathogenic mechanisms underlying COL6A2-related disorders. This research has potential therapeutic implications, as it could lead to the development of targeted treatments for connective tissue diseases, enhancing patient outcomes and quality of life. By elucidating the functional characteristics of COL6A2 through recombinant technology, researchers aim to advance the field of regenerative medicine and tissue engineering, paving the way for innovative strategies to repair or replace damaged tissues.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US