Analytical Data
-
Gene name
COL6A2
- Application
-
Alternative Names
COL6A2；Collagen alpha-2(VI) chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P12110
-
Expression Region
254-400aa
-
AA Sequence
IPGPSGPKGYRGQKGAKGNMGEPGEPGQKGRQGDPGIEGPIGFPGPKGVPGFKGEKGEFGADGRKGAPGLAGKNGTDGQKGKLGRIGPPGCKGDPGNRGPDGYPGEAGSPGERGDQGGKGDPGRPGRRGPPGEIGAKGSKGYQGNSG
-
Molecular Weight
35.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COL6A2, a member of the collagen VI family, plays a crucial role in the structural integrity and function of various tissues, particularly in the extracellular matrix (ECM). Mutations in the COL6A2 gene are associated with several connective tissue disorders, including Ullrich congenital muscular dystrophy and Bethlem myopathy, which are characterized by muscle weakness, joint contractures, and skin abnormalities. Researchers have focused on the recombinant expression of COL6A2 to better understand its biochemical properties and interactions within the ECM. Producing COL6A2 as a recombinant protein allows scientists to explore its role in cellular processes, including cell adhesion, proliferation, and differentiation. Furthermore, understanding the structure-function relationship of COL6A2 may reveal insights into the pathogenic mechanisms underlying COL6A2-related disorders. This research has potential therapeutic implications, as it could lead to the development of targeted treatments for connective tissue diseases, enhancing patient outcomes and quality of life. By elucidating the functional characteristics of COL6A2 through recombinant technology, researchers aim to advance the field of regenerative medicine and tissue engineering, paving the way for innovative strategies to repair or replace damaged tissues.
