Analytical Data
-
Gene name
C14orf179
- Application
-
Alternative Names
Intraflagellar transport Protein 43 homolog
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96FT9
-
Expression Region
1-213 aa
-
AA Sequence
MEDLLDLDEELRYSLATSRAKMGRRAQQESAQAENHLNGKNSSLTLTGETSSAKLPRCRQGGWAGDSVKASNGTQTGKQQLDLNACYHKTHHRNLGLASLEEADIPIIPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDLDNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQARHT
-
Molecular Weight
50.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C14orf179, also known as the C14orf179 gene, encodes a protein whose exact function is still not fully understood, sparking interest in its potential biological roles. Located on chromosome 14, C14orf179 has been implicated in various cellular processes, including cell proliferation and differentiation. Research indicates that dysregulation of genes like C14orf179 may be associated with multiple diseases, including certain types of cancer. Scientists have utilized recombinant technology to produce the C14orf179 protein for in-depth studies, facilitating the investigation of its functional properties and interactions within cellular pathways. By generating this recombinant protein, researchers aim to better understand its structural characteristics and biochemical activities, potentially unveiling its role in the regulation of important cellular functions. Furthermore, elucidating the biological significance of C14orf179 could pave the way for developing novel therapeutic strategies targeting its pathways, contributing to advancements in disease treatment and prevention. The ongoing investigation into C14orf179 highlights the importance of exploring less characterized proteins, which can reveal new insights into molecular biology and contribute to the broader understanding of gene function and regulation in health and disease.
