Cat: PA2000-1922

Recombinant Human CDR2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CDR2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CDR2;PCD17;Cerebellar degeneration-related Protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q01850

  • Expression Region

    1-454aa

  • AA Sequence

    MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQ QMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQK LVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCD QEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKK TVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALEL EAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPE SHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVD TQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVA SGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSL SSHS

  • Molecular Weight

    56 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CDR2, or cancer drug resistance 2, is a protein that has garnered increasing attention in the field of cancer research due to its role in mediating resistance to chemotherapeutic agents. Understanding the mechanisms by which CDR2 contributes to drug resistance is crucial for improving treatment outcomes in cancer patients, as many tumors exhibit a tendency to develop resistance to available therapies, leading to treatment failure. Previous studies have indicated that CDR2 may influence cell survival and proliferation in response to various stressors, including drug treatment. Moreover, its expression levels have been correlated with poor prognosis in several cancer types, highlighting its potential as a biomarker for treatment response. Researchers are investigating the molecular pathways involving CDR2 to elucidate its function and interactions within cancer cells. These efforts aim to identify targeted therapeutic strategies that can overcome drug resistance mediated by CDR2, thereby enhancing the efficacy of existing treatments and potentially improving patient survival rates. The ongoing exploration of CDR2’s role in cancer biology promises to shed light on novel approaches for combating drug resistance and tailoring more effective therapies for individuals facing this challenge.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US