Analytical Data
-
Gene name
C14orf166
- Application
-
Alternative Names
C14orf166; CGI 99; CGI-99; CGI99; Chromosome 14 open reading frame 166; CLE; CLE7; CN166_HUMAN; Homeobox prox 1; LCRP369; RLL motif containing 1; RLLM1; UPF0568 Protein C14orf166
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y224
-
Expression Region
1-244 aa
-
AA Sequence
MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR
-
Molecular Weight
26.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C14orf166, also known as TDRD7, is a gene located on chromosome 14 that encodes a protein of interest due to its potential roles in cellular processes related to reproduction and male fertility. Research has indicated that C14orf166 is significantly involved in the formation of sperm and may play a crucial role in the development of spermatogenesis. Its expression is predominantly observed in testicular tissues, making it a candidate for studying male infertility issues. Additionally, mutations or dysregulation of C14orf166 have been linked to various genetic disorders, underscoring the need to understand its function and regulation at a molecular level. Recombinant C14orf166 protein has been generated for further functional analysis, enabling researchers to investigate its biochemical properties and interactions with other proteins. This study is crucial in elucidating the role of C14orf166 in reproductive biology and its potential implications in therapeutic strategies for infertility and related conditions. The characterization of this protein may yield insights into the mechanistic pathways involved in germ cell development and fertility, providing a foundation for future studies in reproductive health.
