Analytical Data
-
Gene name
C14orf159
- Application
-
Alternative Names
C14orf159; Chromosome 14 Open Reading Frame 159; CN159_HUMAN; UPF0317 Protein C14orf159; mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z3D6
-
Expression Region
1-159 aa
-
AA Sequence
MPFTLHLRSRLPSAIRSLILQKKPNIRNTSSMAGELRPASLVVLPRSLAPAFERFCQVNTGPLPLLGQSEPEKWMLPPQGAISETSLRDLHSAWHRTSLMTVAQERAALPTVLTPSPITWRLSWLRSLRSWRKSSPGEIPLALPSVHSIAQARNPPVQD
-
Molecular Weight
44.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C14orf159, also known as C14orf159 protein or the hypothetical protein, has emerged as a subject of interest in biomedical research due to its potential roles in cellular processes and disease mechanisms. Located on chromosome 14, C14orf159 is believed to be involved in several important biological functions, although its exact role remains largely uncharacterized. Recent studies have highlighted its possible connections to various signaling pathways and cellular stress responses, suggesting that it may play a part in the regulation of gene expression and protein interactions. Its expression patterns have also been linked to specific physiological states, which raises the possibility of its involvement in pathophysiological conditions, including cancer and neurological disorders. The production of recombinant C14orf159 protein allows for detailed functional studies and exploration of its biochemical properties, including interactions with other proteins and its effects on cellular behavior. Understanding the role of C14orf159 is crucial, as it may serve as a novel biomarker or therapeutic target for various diseases. Ongoing research aims to elucidate its precise functions and implications in human health, paving the way for potential advancements in targeted therapies.
