Analytical Data
-
Gene name
CD98
- Application
-
Alternative Names
CD98；MDU1；Amino acid transporter heavy chain SLC3A2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P08195
-
Expression Region
206-630aa
-
AA Sequence
RAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLK VKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVI LDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKD ASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYL SDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQL MLFTLPGTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSA NMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIR HWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQPGREE GSPLELERLKLEPHEGLLLRFPYAAVDHHHHHH
-
Molecular Weight
48 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD98 is a multifunctional protein that plays a critical role in various biological processes, including cell adhesion, proliferation, and amino acid transport. It is a heterodimer composed of the heavy chain CD98hc and light chains variant 1 (LAT1) or LAT2, which are involved in the transport of large neutral amino acids. The elevation of CD98 expression has been associated with several pathological conditions, including cancer progression, where it modulates tumor growth and metastasis by facilitating nutrient uptake and enhancing cell survival in hostile microenvironments. Given its pivotal roles in cell metabolism and signaling, CD98 has emerged as a potential therapeutic target for cancer treatment. Researchers are actively investigating CD98 recombinant proteins to better understand its structure-function relationship and interaction with other cellular components. These studies aim not only to elucidate the mechanisms underlying CD98’s function in normal physiology and disease but also to develop CD98-targeted therapies and diagnostic tools. The recombinant expression of CD98 in various systems enables the exploration of its functional domains, binding partners, and regulatory mechanisms, paving the way for novel interventions in cancer and other diseases associated with dysregulated amino acid transport and cell signaling. Overall, the research on CD98 recombinant proteins stands at the crossroads of cellular biology and therapeutic development, highlighting its importance in both fundamental science and potential clinical applications.
