Cat: PA2000-1914

Recombinant Human CBX7 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CBX7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CBX7;Chromobox Protein homolog 7

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95931

  • Expression Region

    2-90aa

  • AA Sequence

    MHHHHHHELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEP EEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLR

  • Molecular Weight

    12 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CBX7 (Chromobox Protein 7) is a member of the Polycomb group (PcG) proteins, which are crucial regulators of gene expression and chromatin remodeling. These proteins play essential roles in maintaining the silent state of genes involved in developmental processes and cellular differentiation. CBX7 specifically is known for its involvement in transcriptional repression and has been linked to various biological functions, including stem cell maintenance, cell proliferation, and differentiation. Recent studies have highlighted its role in cancer biology, where dysregulation of CBX7 expression has been associated with tumorigenesis and progression. Due to its importance in epigenetic regulation and potential implications in cancer therapy, the study of CBX7 recombinant proteins has gained significant attention. Researchers have aimed to produce and characterize CBX7 recombinant protein to better understand its structural properties, binding interactions, and functional roles in cellular processes. The study of CBX7 could potentially lead to novel therapeutic strategies targeting epigenetic mechanisms in cancer and other diseases, underscoring the significance of this protein in both basic and translational research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US