Analytical Data
-
Gene name
CBX7
- Application
-
Alternative Names
CBX7；Chromobox Protein homolog 7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95931
-
Expression Region
2-90aa
-
AA Sequence
MHHHHHHELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEP EEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLR
-
Molecular Weight
12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CBX7 (Chromobox Protein 7) is a member of the Polycomb group (PcG) proteins, which are crucial regulators of gene expression and chromatin remodeling. These proteins play essential roles in maintaining the silent state of genes involved in developmental processes and cellular differentiation. CBX7 specifically is known for its involvement in transcriptional repression and has been linked to various biological functions, including stem cell maintenance, cell proliferation, and differentiation. Recent studies have highlighted its role in cancer biology, where dysregulation of CBX7 expression has been associated with tumorigenesis and progression. Due to its importance in epigenetic regulation and potential implications in cancer therapy, the study of CBX7 recombinant proteins has gained significant attention. Researchers have aimed to produce and characterize CBX7 recombinant protein to better understand its structural properties, binding interactions, and functional roles in cellular processes. The study of CBX7 could potentially lead to novel therapeutic strategies targeting epigenetic mechanisms in cancer and other diseases, underscoring the significance of this protein in both basic and translational research.
