Analytical Data
-
Gene name
C14orf139
- Application
-
Alternative Names
Nesprin-3. KASH domain-containing Protein 3. KASH3. Nuclear envelope spectrin repeat Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6ZMZ3
-
Expression Region
1-190aa
-
AA Sequence
MVQQDVQGLKAQSAGLSISQHLLSGCHGNIIPNPTTLSSRETAIIRRDLGFPRGSWASFLKRLLLSSATRNTRPAHPQHLCGDEGQSPTVPLPVLMRKGGKKTYPERLQYGHDTFKKPVLWSHDQKPECGEGQQPASEQPARRGVVNLGLVPRHDWLRAQCSTLWNVPWASVAFLSFAGRGLLPLWQLVS
-
Molecular Weight
47.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C14orf139, also known as "CHROMOSOME 14 OPEN READING FRAME 139," has emerged as a protein of interest in recent years due to its potential role in various cellular processes and implications in human diseases. As a relatively uncharacterized protein, initial studies suggest that C14orf139 may be involved in cellular signaling, immune responses, and even cancer progression. Its precise biological function remains largely elusive, making it a compelling target for further investigation. Recent advances in recombinant protein technology allow for the production of C14orf139 in sufficient quantities for in vitro studies, enabling researchers to explore its structure, function, and interactions with other cellular components. Understanding C14orf139’s biological significance could provide insights into its involvement in pathophysiological conditions, paving the way for potential therapeutic interventions. As such, ongoing research into the recombinant expression and purification of C14orf139 aims to elucidate its functional properties and biological relevance, facilitating a comprehensive understanding of its role in human health and disease.
