Cat: PA2000-1909

Recombinant Human C21orf2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C21orf2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    C21orf2;C21orf2;LRRC76;Cilia- and flagella-associated Protein 410

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O43822

  • Expression Region

    1-375aa

  • AA Sequence

    MKLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPSLEVITLSVN SISTLEPVSRCQRLSELYLRRNRIPSLAELFYLKGLPRLRVLWLAENPCC GTSPHRYRMTVLRTLPRLQKLDNQAVTEEELSRALSEGEEITAAPEREGT GHGGPKLCCTLSSLSSAAETGRDPLDSEEEATGAQDERGLKPPSRGQFPS LSARDASSSHRGRVSGGPLGAAAASAHCTHCTETVGREHGASQGPVGREH GASQGLEELCPRGSCVCGSVNAHTRVTRAPHGAVLAPQPLLLSWSVECGP GPCWAEGNRSHVEEVPHTRPQAGLLCSDSPSVPNVLTAILLLLRELDAEG LEAVQQTVGSRLQALRGEEVQEHAE

  • Molecular Weight

    40 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C21orf2, also known as chromosome 21 open reading frame 2, is a gene located on human chromosome 21 that has garnered attention due to its potential involvement in various cellular processes and diseases, particularly in the context of Down syndrome, which is caused by an extra copy of chromosome 21. Recent studies have indicated that C21orf2 may play a role in cellular signaling, metabolism, and possibly the regulation of gene expression. The protein encoded by C21orf2 remains largely uncharacterized, and understanding its structure and function is crucial for elucidating its biological role. Researchers have begun to produce recombinant C21orf2 protein to investigate its properties, interactions, and functional implications in cellular systems. The availability of this recombinant protein enables more detailed biochemical assays, structural studies, and functional analyses. Moreover, insights gained from C21orf2 research may contribute to a deeper understanding of Down syndrome pathology, offering avenues for therapeutic intervention. Overall, the study of recombinant C21orf2 protein is positioned at the intersection of genetic research, molecular biology, and potential clinical applications, making it a significant focus in contemporary biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US