Cat: PA2000-5966

Recombinant Human C14orf126 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C14orf126

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DTD2; C14orf126D-aminoacyl-tRNA deacylase 2; EC 3.1.1.96; Animalia-specific tRNA deacylase; ATD; D-tyrosyl-tRNA(Tyr) deacylase 2; L-alanyl-tRNA deacylase

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96FN9

  • Expression Region

    1-168aa

  • AA Sequence

    MAEGSRIPQARALLQQCLHARLQIRPADGDVAAQWVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIEF

  • Molecular Weight

    45.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C14orf126, also known as PNKP (polynucleotide kinase/phosphatase), plays a critical role in DNA repair pathways, particularly in the maintenance of genomic stability. Its gene is located on chromosome 14 and is involved in the repair of single-strand breaks in DNA through its enzymatic activities. Deficiencies in C14orf126 have been associated with various diseases, including cancer, where impaired DNA repair mechanisms can lead to increased mutagenesis and tumorigenesis. Recent studies have highlighted the importance of C14orf126 in neuronal health, with mutations linked to neurodegenerative disorders, underscoring its relevance in both cancer biology and neurobiology. The recombinant protein of C14orf126 is being explored to better understand its biochemical functions and interactions within the DNA repair machinery. Structural and functional studies of this protein could provide insights into its mechanism of action, potential regulatory pathways, and its role in cellular responses to DNA damage. Furthermore, understanding C14orf126's interactions with other key proteins may uncover new therapeutic targets for enhancing DNA repair in diseased cells, offering a promising avenue for cancer treatment and neuroprotection strategies. Overall, C14orf126 represents a significant focal point in the study of DNA damage response and repair, making it a vital subject for ongoing research in genomics and molecular biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US