Analytical Data
-
Gene name
CRISP3
- Application
-
Alternative Names
CRISP3；；Cysteine-rich secretory Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P54108
-
Expression Region
21-245aa
-
AA Sequence
NEDKDPAFTALLTTQTQVQREIVNKHNELRRAVSPPARNMLKMEWNKEAA ANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSASSSWSQAIQSWFDEY NDFDFGVGPKTPNAVVGHYTQVVWYSSYLVGCGNAYCPNQKVLKYYYVCQ YCPAGNWANRLYVPYEQGAPCASCPDNCDDGLCTNGCKYEDLYSNCKSLK LTLTCKHQLVRDSCKASCNCSNSIYVDHHHHHH
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CRISP3, a member of the cysteine-rich secretory protein (CRISP) family, has garnered attention due to its potential role in various physiological and pathological processes. Initially identified in the context of reproductive biology, CRISP3 is predominantly expressed in the male reproductive tract, particularly in the epididymis, and has been implicated in sperm maturation and function. Recent studies suggest that CRISP3 may also play a significant role in immune responses, inflammation, and cancer biology, indicating its involvement in a wider array of biological systems. The protein exhibits several functional characteristics, including interaction with glycosaminoglycans and cytokines, which influence cell signaling pathways. Furthermore, its expression levels have been associated with certain diseases, such as prostate cancer, highlighting its potential as a biomarker or therapeutic target. Understanding the structure-function relationship of CRISP3 through the study of its recombinant protein is crucial for elucidating its biological roles and mechanisms of action. The development of recombinant CRISP3 not only provides a platform for in-depth functional studies but also aids in the exploration of its therapeutic applications, paving the way for innovative strategies in disease intervention and treatment. Overall, the investigation of CRISP3 recombinant protein offers promising insights into its multifaceted roles in health and disease.
