Analytical Data
-
Gene name
IMUP
- Application
-
Alternative Names
IMUP；C19orf33；Immortalization up-regulated Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9GZP8
-
Expression Region
1-85aa
-
AA Sequence
MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKASNFRGLGKGRRLTAAPPSSKDTTALPTPAAAPAIRTRM
-
Molecular Weight
35.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IMUP (Interleukin-10-modulating immunoglobulin and mucin-domain protein) is a novel recombinant protein that has garnered attention in recent years due to its potential therapeutic applications in inflammatory and autoimmune diseases. The research surrounding IMUP stems from the need for innovative treatments that can effectively regulate immune responses without compromising overall immune function. Studies have shown that IMUP plays a critical role in modulating cytokine production, particularly interleukin-10, which is vital for maintaining immune homeostasis and mitigating excessive inflammation. This protein's unique structure, comprising both immunoglobulin and mucin domains, facilitates its interaction with immune cells, making it a promising candidate for drug development. Furthermore, the increasing prevalence of chronic inflammatory conditions, along with the limitations of current therapies, has propelled interest in IMUP as a safer, more effective alternative. Researchers are exploring various aspects of IMUP, including its mechanism of action, biological activity, and potential applications in clinical settings. These investigations aim not only to enhance the understanding of its role in immune regulation but also to pave the way for innovative therapeutic strategies that could significantly improve patient outcomes in the realm of immunology. As a result, IMUP represents an exciting frontier in the quest for advanced interventions in immune-mediated disorders.
