Analytical Data
-
Gene name
BGLAP
- Application
-
Alternative Names
BGLAP；Osteocalcin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02818
-
Expression Region
1-100aa
-
AA Sequence
MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
-
Molecular Weight
10.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BGLAP, also known as osteocalcin, is a non-collagenous protein primarily produced by osteoblasts and is considered a critical marker of bone metabolism. Research surrounding BGLAP re-combinant protein has garnered attention due to its potential implications in osteogenesis, bone remodeling, and metabolic disorders. Osteocalcin plays a pivotal role in the regulation of mineralization and interacts with hydroxyapatite, influencing bone strength and structure. Furthermore, emerging studies suggest that BGLAP may link bone health to energy metabolism, exhibiting an endocrine function that affects insulin sensitivity and the regulation of glucose homeostasis. As a result, understanding the properties and functions of recombinant BGLAP is crucial for applications in bone tissue engineering, therapeutic interventions for metabolic diseases, and the development of diagnostic tools for osteoporosis and other skeletal disorders. The production of recombinant BGLAP facilitates detailed studies of its biological activities, mechanisms of action, and physiological relevance, paving the way for novel therapeutic strategies and improving our understanding of bone-related pathologies. This research not only contributes to the field of bone biology but also holds promise for innovative treatment approaches in regenerative medicine and metabolic health.
