Analytical Data
-
Gene name
C14orf100
- Application
-
Alternative Names
JKAMP; C14orf100; JAMP; CDA06; HSPC213; HSPC327; JNK1/MAPK8-associated membrane Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9P055
-
Expression Region
1-311aa
-
AA Sequence
MAVDIQPACLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKYCQPCTESPELYDWLYLGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECSMAAIITLLVSDPVGVLYIRSCRVLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFIYYAFCLVLMMLLRPLLVKKIACGLGKSDRFKSIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLSLVTLAVYMSASEIENCYDLLVRKKRLIVLFSHWLLHAYGIISISRVDKLEQDLPLLALVPTPALFYLFTAKFTEPSRILSEGANGH
-
Molecular Weight
35.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C14orf100, also known as "Chromosome 14 open reading frame 100," is a gene located on chromosome 14 that has garnered interest due to its potential implications in various biological processes and diseases. Research has indicated that C14orf100 may play a role in cellular functions such as proliferation, differentiation, and apoptosis, although its precise biological functions remain largely unclear. Studies have suggested that this protein could be involved in cancer biology, neurodegenerative disorders, and metabolic diseases, prompting scientists to investigate its structure and interactions with other cellular components. The recombinant protein production of C14orf100 allows for a detailed examination of its biochemical properties and functional characteristics in vitro, enabling researchers to elucidate its mechanisms of action. By understanding how C14orf100 operates at the molecular level, researchers hope to clarify its role in health and disease, potentially identifying it as a novel therapeutic target or biomarker. The ongoing exploration of C14orf100 is critical for advancing our knowledge of its significance in human biology and its potential implications for treatment strategies in various conditions.
