Analytical Data
-
Gene name
TFF2
- Application
-
Alternative Names
TFF2；SML1；Trefoil factor 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q03403
-
Expression Region
24-129aa
-
AA Sequence
EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPL PKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKS VEDCHY
-
Molecular Weight
12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TFF2, or trefoil factor 2, is a peptide belonging to the trefoil factor family, which plays a crucial role in mucosal protection and repair. It is predominantly expressed in the gastrointestinal tract, particularly in the gastric mucosa, and is involved in maintaining the integrity of the gastric epithelium, promoting cell proliferation, and facilitating wound healing. Research on TFF2 recombinant protein has gained interest due to its potential therapeutic applications in various gastrointestinal disorders, including ulcers, inflammatory bowel disease, and even certain cancers. The protective mechanisms of TFF2 are thought to stem from its ability to promote the migration and differentiation of epithelial cells, as well as its role in modulating inflammatory responses. Advances in recombinant protein technology have enabled the production of TFF2 at scale, allowing for detailed studies on its structure-function relationship and biological activity. This has opened new avenues for exploring TFF2 as a biomarker for disease progression and a target for developing novel therapeutic strategies aimed at enhancing mucosal healing and restoring gastrointestinal function. Understanding the molecular pathways influenced by TFF2 could lead to groundbreaking insights into mucosal biology and the development of innovative treatments for patients suffering from mucosal-related disorders.
