Analytical Data
-
Gene name
C13orf3
- Application
-
Alternative Names
C13orf3; RAMA1; SKA3; SKA3_HUMAN; Spindle and kinetochore associated complex subunit 3; Spindle and kinetochore-associated Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IX90
-
Expression Region
1-303aa
-
AA Sequence
MAGAACEPVARPSLTSISSGELRSLWTCDCELALLPLAQLLRLQPGAFQLSGDQLVVAGPGEPAAARGGFNVFGDGLVRLDGQLYRLSSYIKRYVELTNYCDYKDYRETILSKPMLFFINVQTKKDTSKERTYAFLVNTRHPKIRRQIEQGMDMVISSVIGESYRLQFDFQEAVKNFFPPGNEVVNGENLSFAYEFKADALFDFFYWFGLSNSVVKVNGKVLNLSSTSPEKKETIKLFLEKMSEPLIRRSSFSDRKFSVTSRGSIDDVFNCNLSPRSSLTEPLLAELPFPSVLESEETPNQFI
-
Molecular Weight
60.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C13orf3, also known as Chromosome 13 open reading frame 3, has garnered attention in recent years due to its potential implications in various biological processes and diseases, including cancer. Initially identified as a gene located on chromosome 13, studies have suggested that C13orf3 may play a role in regulating cell proliferation and apoptosis. Its expression levels have been found to be altered in several tumor types, indicating a possible involvement in tumorigenesis and cancer progression. Additionally, C13orf3 has been implicated in immune response modulation, highlighting its relevance in autoimmune diseases. Given the poorly understood functional mechanisms of C13orf3, research efforts have increasingly focused on generating recombinant proteins for in-depth biochemical characterization. Recombinant C13orf3 proteins can be utilized to elucidate its structure-function relationships, investigate its interactions with other cellular proteins, and evaluate its biological activity in vitro and in vivo. These studies are critical for establishing a comprehensive understanding of the molecular pathways involving C13orf3 and may pave the way for developing targeted therapies for diseases associated with its dysregulation. By advancing our knowledge of C13orf3, researchers aim to clarify its role in health and disease and explore its potential as a biomarker or therapeutic target in clinical settings.
