Analytical Data
-
Gene name
CDSN
- Application
-
Alternative Names
CDSN；Corneodesmosin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15517
-
Expression Region
442-529aa
-
AA Sequence
KIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAGAKPCGSSSA GKIPCRSIRDILAQVKPLGPQLADPEVFLPQGELLNSP
-
Molecular Weight
35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of CDSN (cysteine-rich domain protein) recombinant proteins has gained significant attention in recent years due to their potential roles in various biological processes, particularly in skin and immune system functions. CDSN is primarily expressed in the epidermis and is implicated in cellular adhesion, proliferation, and differentiation, all critical for maintaining skin integrity. Alterations in CDSN expression have been associated with skin disorders, including psoriasis and other inflammatory conditions, highlighting its importance in dermatological research. Furthermore, the unique structure of CDSN, characterized by multiple cysteine-rich motifs, paves the way for its interactions with other proteins and signaling pathways. By producing recombinant forms of CDSN, researchers can explore its biochemical properties, functional mechanisms, and therapeutic potentials. The insights gained from these studies may lead to novel strategies for treating skin-related diseases and improving regenerative medicine approaches. Overall, CDSN recombinant protein research represents a promising frontier in understanding skin biology and developing targeted therapies.
