Analytical Data
-
Gene name
ASAH2B
- Application
-
Alternative Names
ASAH2B；ASAH2C；ASAH2L；Putative inactive neutral ceramidase B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0C7U1
-
Expression Region
1-165aa
-
AA Sequence
MRQHRQFMDRTHYLLTFSSSETLLRLLLRIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI
-
Molecular Weight
21.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ASAH2B, a member of the N-acylsphingosine amidohydrolase family, plays a crucial role in sphingolipid metabolism by catalyzing the hydrolysis of sphingosine N-acyls in various biological processes. The study of ASAH2B has gained significance due to its involvement in diverse physiological functions and its potential implications in several diseases, including cancer, neurodegenerative disorders, and inflammation. Research indicates that alterations in the expression or activity of ASAH2B can lead to dysregulation of sphingolipid homeostasis, which is linked to the development of pathologies. Specifically, the enzyme's substrate specificity and its role in producing bioactive lipids have made it a target for therapeutic intervention. Understanding the mechanistic aspects of ASAH2B, including its structure, function, and regulatory pathways, is vital for elucidating its contribution to lipid signaling and metabolic regulation. Additionally, the generation of recombinant ASAH2B proteins allows for detailed biochemical studies, enabling researchers to explore its enzymatic properties and potential interactions with other molecules. This research not only enhances our understanding of sphingolipid metabolism but also opens avenues for developing novel therapeutic strategies aimed at modulating ASAH2B activity in disease contexts. Thus, the study of ASAH2B is at the forefront of lipid biochemistry and holds promise for advancing both basic research and clinical applications.
