Analytical Data
-
Gene name
PRB3
- Application
-
Alternative Names
Basic salivary proline-rich protein 3. Parotid salivary glycoprotein G1. Proline-rich protein G1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q04118
-
Expression Region
1-162 aa
-
AA Sequence
MLLILLSVALLALSSAQSLNEDVSQEESPSVISGKPEGRRPQGGNQPQRTPPPPGKPEGRPPQGGNQSQGPPPRPGKPEGQPPQGGNKPQGPPPHPGKPQGPPPQEGNKPQRPPPPGRPQGPPPPGGNPQQPLPPPAGKPQGPPPPPQGGRPHRPPQGQPPQ
-
Molecular Weight
43 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRB3 (Prostate-Specific Antigen, Human Protein) is a member of the serine protease family and is primarily expressed in prostate tissues. Its study has garnered significant attention due to its potential role in prostate cancer progression and diagnosis. In recent years, advances in recombinant DNA technology have enabled researchers to produce PRB3 as a recombinant protein, allowing for more detailed investigations into its biological functions and interactions. The recombinant form of PRB3 provides a valuable tool for understanding how this protein may facilitate tumor growth and metastasis, as it may be involved in various cellular processes such as apoptosis, cell migration, and immune response modulation. Furthermore, characterizing PRB3 as a biomarker could improve early detection of prostate cancer and help tailor more effective therapeutic strategies. Current research efforts are focused on elucidating the molecular mechanisms through which PRB3 operates, as well as exploring its potential as a therapeutic target. Overall, the study of recombinant PRB3 not only enhances our understanding of prostate cancer biology but also holds promise for improving clinical outcomes for patients affected by this disease.
