Analytical Data
-
Gene name
C12orf64
- Application
-
Alternative Names
OTOGL; C12orf64; Otogelin-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3ZCN5
-
Expression Region
1-224aa
-
AA Sequence
MIKYLEEDFCYAIECLEEKDNHTGFHTLNFTLVNCSKKCDVHQVYTPSPSDYGCCGTCKNVSCKFHMENGTSVVYAVGSTWHYNCTTYECVKTDEGAIILNYTMVCPPFNETECKMNEGIVKLYNEGCCKICKREERICQKVIIKSVIRKQDCMSQSPINVASCDGKCPSATIYNINIESHLRFCKCCRENGVRNLSVPLYCSGNGTEIMYTLQEPIDCTCQWN
-
Molecular Weight
51.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C12orf64, also known as Chromosome 12 Open Reading Frame 64, is a relatively less characterized protein that has garnered interest due to its potential roles in various biological processes. Initial studies have suggested that C12orf64 may be involved in cellular functions such as cell signaling and metabolism, but its precise function remains largely unknown. The protein is encoded by a gene located on chromosome 12 and is expressed in various tissues, indicating potential involvement in both normal physiological processes and pathological conditions. Researchers are particularly interested in understanding its relationship with diseases, as emerging evidence suggests that dysregulation of C12orf64 could be linked to conditions such as cancer and metabolic disorders. The development of recombinant C12orf64 protein through techniques such as cloning and expression in host cells allows for detailed biochemical studies, enabling scientists to elucidate its structure, function, and interaction with other cellular components. By investigating the properties and biological significance of this protein, researchers aim to uncover its role in health and disease, which could eventually translate into novel therapeutic strategies. Understanding C12orf64 could provide critical insights into the underlying mechanisms of diseases and identify potential biomarkers for diagnosis and treatment.











