Analytical Data
-
Gene name
OR1A1
- Application
-
Alternative Names
OR1A1;Olfactory receptor 1A1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9P1Q5
-
Expression Region
1-309aa
-
AA Sequence
MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVRLHNPMYFLLANLSLVDIFFSSVTIPKMLANHLLGSKSISFGGCLTQMYFMIALGNTDSYILAAMAYDRAVAISRPLHYTTIMSPRSCIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCDITPLLKLSCSDIHFHVKMMYLGVGIFSVPLLCIIVSYIRVFSTVFQVPSTKGVLKAFSTCGSHLTVVSLYYGTVMGTYFRPLTNYSLKDAVITVMYTAVTPMLNPFIYSLRNRDMKAALRKLFNKRISS
-
Molecular Weight
34.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OR1A1 gene encodes a member of the olfactory receptor family, which plays a crucial role in the sense of smell by enabling the detection of volatile chemical substances. Recent studies have begun to explore the functional nuances of the OR1A1 receptor, particularly its potential implications in human health and disease. Research has highlighted the importance of OR1A1 in various physiological processes, including wound healing and immune responses, suggesting that olfactory receptors may extend beyond sensory functions. Furthermore, the recombinant expression of OR1A1 protein offers valuable insights into its structure-function relationships, allowing researchers to investigate its ligand-binding properties and signaling pathways in a controlled environment. By using recombinant technology, scientists can produce large quantities of OR1A1, providing a platform for high-throughput screening of potential therapeutic agents that may modulate its activity. Additionally, understanding the molecular interactions of OR1A1 could pave the way for novel strategies in drug development, particularly in treating conditions linked to olfactory dysfunction or other related disorders. As the body of research on OR1A1 continues to grow, it is poised to reveal new dimensions of olfactory biology and its applications in biotechnology and medicine.











