Cat: PA1000-4246

Recombinant Human HO1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HO1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HO1;HO;Heme oxygenase 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P09601

  • Expression Region

    1-288aa

  • AA Sequence

    MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLV MASLYHIYVA LEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYG PRWQEVIPYTPAMQRYVKRLHE VGRTEPELLVAHAYTRYLGDLSGGQV LKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ LYRSRMNSLEMTPA VRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRA SN KVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM

  • Molecular Weight

    32 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HO1, or heme oxygenase-1, is an important enzyme that plays a crucial role in heme catabolism, converting heme into biliverdin, carbon monoxide, and free iron. This enzyme is part of the body’s response to oxidative stress and inflammation, and its expression is regulated by various stimuli, including cytokines and hypoxia. The significance of HO1 has been particularly highlighted in various pathological conditions, such as cardiovascular diseases, neurodegenerative disorders, and cancer, where it exhibits cytoprotective, anti-inflammatory, and anti-apoptotic properties. Research on recombinant HO1 protein has gained momentum due to its potential therapeutic applications. By producing HO1 in recombinant systems, researchers can obtain large quantities of the enzyme for detailed biochemical studies, therapeutic enzyme replacement, or exploration of its roles in disease models. Additionally, understanding the structure-function relationships of HO1 through recombinant protein studies may reveal novel targets for drug development and biomarker identification. The ongoing research aims to elucidate the mechanisms by which HO1 exerts its protective effects and to explore its therapeutic potential in clinical settings. Overall, HO1 recombinant protein research is pivotal for advancing our knowledge of its biological functions and therapeutic implications in various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US