Analytical Data
-
Gene name
CD40L
- Application
-
Alternative Names
CD40L；CD40L；CD40 ligand
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P29965
-
Expression Region
113-261aa
-
AA Sequence
MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLT VKRQGLYYIYAQVTFCSNREASSQAPFIASLCLKSPGRFERILLRAANTH SSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL
-
Molecular Weight
16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD40 ligand (CD40L), a member of the tumor necrosis factor (TNF) superfamily, plays a crucial role in mediating immune responses by activating CD40 on antigen-presenting cells (APCs). This interaction is vital for B cell activation, antibody production, and the development of immune memory. Dysregulation of CD40-CD40L signaling is implicated in various autoimmune diseases, cancers, and immunodeficiencies. Given its importance, recombinant CD40L protein has been extensively studied for its potential therapeutic applications. Researchers have explored its use in enhancing vaccine efficacy, promoting antitumor immunity, and modulating immune responses in transplantation and autoimmune disorders. The recombinant form allows for precise characterization of CD40L's biological activities and enables the development of targeted therapies. Advances in recombinant DNA technology and protein purification techniques have facilitated the production of high-quality CD40L, enabling detailed investigations into its mechanisms of action and therapeutic potential. As a result, CD40L emerges as a promising target for innovative immunotherapies aimed at harnessing the immune system to combat various diseases.
