Cat: PA1000-4213

Recombinant Human CD40L Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD40L

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CD40L;CD40L;CD40 ligand

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P29965

  • Expression Region

    113-261aa

  • AA Sequence

    MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLT VKRQGLYYIYAQVTFCSNREASSQAPFIASLCLKSPGRFERILLRAANTH SSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL

  • Molecular Weight

    16 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD40 ligand (CD40L), a member of the tumor necrosis factor (TNF) superfamily, plays a crucial role in mediating immune responses by activating CD40 on antigen-presenting cells (APCs). This interaction is vital for B cell activation, antibody production, and the development of immune memory. Dysregulation of CD40-CD40L signaling is implicated in various autoimmune diseases, cancers, and immunodeficiencies. Given its importance, recombinant CD40L protein has been extensively studied for its potential therapeutic applications. Researchers have explored its use in enhancing vaccine efficacy, promoting antitumor immunity, and modulating immune responses in transplantation and autoimmune disorders. The recombinant form allows for precise characterization of CD40L's biological activities and enables the development of targeted therapies. Advances in recombinant DNA technology and protein purification techniques have facilitated the production of high-quality CD40L, enabling detailed investigations into its mechanisms of action and therapeutic potential. As a result, CD40L emerges as a promising target for innovative immunotherapies aimed at harnessing the immune system to combat various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US