Analytical Data
-
Gene name
PPM1L
- Application
-
Alternative Names
PPM1L; PP2CE; Protein phosphatase 1L; EC 3.1.3.16; Protein phosphatase 1-like; Protein phosphatase 2C isoform epsilon; PP2C-epsilon
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5SGD2
-
Expression Region
1-360 aa
-
AA Sequence
MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVKGKVAEIMQNDRLGGLDVLEAEFSKTWEFKNHNVAVYSIQGRRDHMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVKSRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSKTEEQ
-
Molecular Weight
67.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPM1L (Protein Phosphatase, Magnesium Dependent 1L) is a member of the protein phosphatase family, specifically functioning as a magnesium-dependent serine/threonine phosphatase. Its role is critical in various cellular processes, including cell signaling, stress response, and the regulation of the cell cycle. Research has shown that PPM1L plays a significant role in dephosphorylating target proteins involved in key signaling pathways such as MAPK and PI3K/Akt. Dysregulation of PPM1L has been linked to several diseases, including cancer and metabolic disorders, making it an important target for therapeutic interventions. Additionally, PPM1L is implicated in the modulation of immune responses and the regulation of apoptosis, highlighting its potential influence on both innate and adaptive immunity. Given its central role in various biological processes, the recombinant production of PPM1L is essential for studying its functional mechanisms, post-translational modifications, and interactions with other cellular proteins. The ability to produce PPM1L as a recombinant protein allows for the exploration of its structural characteristics and enzymatic activities, providing insights into its biological roles and potential as a drug target. Understanding PPM1L at the molecular level could lead to novel approaches for treating diseases associated with its dysfunction, representing a promising avenue in biomedical research.
